PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EcC047932.10
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family bZIP
Protein Properties Length: 575aa    MW: 62986.6 Da    PI: 6.8088
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EcC047932.10genomeECGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_131.24.9e-10426483562
                   CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
        bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklkse 62 
                   kr +r   NR +A rs +RK  +i+eLe kv++L++e ++L  +l  l+  +  l+++
  EcC047932.10 426 KRVKRILANRQSAARSKERKMRYIQELEHKVQTLQTEATTLSAQLTLLQRDSVGLTNQ 483
                   899******************************************9998877666665 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003381.1E-18422486IPR004827Basic-leucine zipper domain
PfamPF077164.2E-9423475IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.852424487IPR004827Basic-leucine zipper domain
SuperFamilySSF579591.76E-11426482No hitNo description
Gene3DG3DSA:1.20.5.1703.7E-11426482No hitNo description
CDDcd147033.27E-23427476No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009733Biological Processresponse to auxin
GO:0005634Cellular Componentnucleus
GO:0005829Cellular Componentcytosol
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 575 aa     Download sequence    Send to blast
MGDAEDSRND TSRGLQSSFG TLQPKQAFSM NHLDIPHLSA PDMRAPMRQF AQSFVGDGNK  60
RAGIPPSHPN QIPPISPYSQ IPMPRPLNQQ MGSPNFSHGP THSRSLSQPS IFNFDNLPPL  120
SPSPFRDSPS STSISDHVSG DVSMEDRDAS SHPLLPPSPF PRGNPSRIGE SLPPRKAHRR  180
SNSDIPFLSS LMQSSPPLIP SSSSKGLGTL ERSVSGRESM SSAKPAQLVK KESSWDRGVY  240
SNAEGMGERK SEGEVVDDLF SAYMNLDGID ALNSSETDEK NGTETREDLD SRASGTKTNG  300
GDSSDNEAES SVNECGNSMQ RLGMNSSSEK REGIKRSAGE DIAPASRHYR SVSMDSFMGK  360
LNFADESTKM PPSPGVRPGQ LSPRNSIDGN SNTFSLEFGN GEFSGAELKK IMANDKLAEI  420
ALTDPKRVKR ILANRQSAAR SKERKMRYIQ ELEHKVQTLQ TEATTLSAQL TLLQRDSVGL  480
TNQNNELKFR LQAMEQQAQL RDALNEALTA EVQRLKLATA ELNSESHPSK CMVSQLPVNS  540
QMFQLHQMQQ QQQSQQQTQS QQQNGNTTTK SESNQ
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010028661.10.0PREDICTED: uncharacterized protein LOC104418889
TrEMBLA0A059ANP70.0A0A059ANP7_EUCGR; Uncharacterized protein
STRINGVIT_03s0038g00860.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM42242757
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G38900.31e-153bZIP family protein